CJC-1295 2mg / vials Púdar Peptides Leofilithe

CJC-1295 2mg Vials Peptides Lioifilithe CAS 863288-34-0 le haghaidh Feabhsúcháin
Ainm Táirge: CJC1295
CAS: 863288-34-0
MF: C159H258N46O45
Chatear nu'bya

Sonraí Táirge

CJC-1295 2mg Vials Peptides Lioifilithe CAS 863288-34-0 le haghaidh Feabhsúcháin

Ainm Táirge: CJC1295
Comhchiallaigh: CJC1295; Y (d -A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L- Sraithil-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl- L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3- (2,5-dihydro-2,5-dioxo-1H- pyrrol-1-il) -1-oxopropyl] -L-lysinamide; CJC-1295 Aicéatáit; CJC1295 le DAC; -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl; L-Tyrosyl -D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl -L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl
CAS: 863288-34-0
MF: C159H258N46O45


Conas CJC-1295 a úsáid?

De ghnáth, cuirtear CJC 1295 ar fáil i vials ina bhfuil 2 nó 5 mg de phúdar leataithe, cé gur féidir an méid a athrú. Ba cheart an t-ábhar a athbhunú trí mhéid áisiúil uisce steiriúla nó baictéireatatach a chur leis. Má roghnaítear 2 ml mar shampla agus is é 2 mg an dáileadh an vial, agus ansin tá tiúchan 1 mg / ml ann nó 1000 mcg / m.

Ag am an dáileadh, úsáidtear steallaire inslíne chun an méid atá ag teastáil a tharraingt agus ansin a instealladh. Sa sampla thuas, bheadh gá le méid 1 ml, nó "100 IU", marcáilte ar steallaire insulin ar dháileog 1000 mcg.


Féadfaidh instealladh a bheith subcutaneous, intramuscular, nó intravenous de réir rogha pearsanta. Más gá, féadfar réitigh peptide ó vials eile, mar shampla vial de tháirge GHRP, a tharraingt isteach sa steallaire céanna, má tá seomra ann. Laghdaíonn sé seo líon iomlán na n-insteallta atá ag teastáil.

Agus tú ag moladh CJC 1295, de ghnáth, molann mé dosage de 1000 mcg ag an am, dhá uair sa tseachtain.


CJC-1295 gan Iarratas DAC:

Fuarthas go raibh príomhfheidhm CJC 1295 ar chruthú go raibh síntéis próitéin a mhéadú, méadú fás ar fhíochán muscle agus go leor sochair eile ag teacht leis. Cuidíonn CJC 1295 freisin le huaireanna aisghabhálacha díobhála, saille comhlacht a laghdú, córas imdhíonachta a neartú agus dlús cnámh agus deisiú cheallacha (craiceann agus orgáin).


MGF, 2mg

PEG MGF, 2mg

CJC-1295 DAC, 2mg

CJC-1295, 2mg

PT141, 10mg

Melanotan-2, 10mg

GHRP-2, 10mg

GHRP-6, 10mg

GHRP-2, 5mg

GHRP-6, 5mg

Ipamorelin, 2mg

Hexarelin, 2mg

Sermorelin, 2mg

Oxytocin, 2mg

TB500, 2mg

HGH 176-191, 2mg

Triptorelin, 2mg

Tesamorelin, 2mg

Gonadorelin, 2mg

Gonadorelin, 10mg

DSIP, 2mg

Selank, 5mg

BPC 157, 2mg

Epitalon, 10mg

Follistatin 344, 1mg

AOD-9604, 2mg

Deslorelin, 20mg

IGF-1 LR3, 0.1mg

Follistatin 315, 1mg

Dermorphin, 10mg

Thymosin α1 Aicéatáit, 10mg

ACE 031, 1mg

GDF-8, 1mg


图片15.jpg

Hot Tags: CJC-1295 2mg / vials púdar peptides fhéifilithe, an tSín, soláthróirí, lascaine, ceannach, mórchóir, pricelist, ardchaighdeán, i stoc

Fiosrúchán

B’fhéidir gur mhaith leat freisin